Structure of PDB 8uvr Chain 2m

Receptor sequence

>8uvr2m (length=122) Species: 300852 (Thermus thermophilus HB8)

RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAE
VVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
TRTNARTRKGPRKTVAGKKKAP

3D structure

• PDB: 8uvr Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.
• Chain: 2m
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2m	K13 R14 V17 Y21 Y23 G24 I25 G26 A28 R29 R44 V74 N77 I78 Y87 R88 R91 H92 P97 V98 R99 G100 Q101 R102 T103 R104 T105 N106 R108 T109 K111 R114 K115 T116 V117 K120	K11 R12 V15 Y19 Y21 G22 I23 G24 A26 R27 R42 V72 N75 I76 Y85 R86 R89 H90 P95 V96 R97 G98 Q99 R100 T101 R102 T103 N104 R106 T107 K109 R112 K113 T114 V115 K118

External links

• PDB: RCSB:8uvr, PDBe:8uvr, PDBj:8uvr
• PDBsum: 8uvr
• PubMed: 38165935
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)