Structure of PDB 7jqm Chain 2m

Receptor sequence

>7jqm2m (length=122) Species: 300852 (Thermus thermophilus HB8)

RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAE
VVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
TRTNARTRKGPRKTVAGKKKAP

3D structure

• PDB: 7jqm Peptide Inhibitors of Bacterial Protein Synthesis with Broad Spectrum and SbmA-Independent Bactericidal Activity against Clinical Pathogens.
• Chain: 2m
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2m	M82 R93	M80 R91
BS02	rna	2m	K13 R14 Y21 Y23 G24 I25 G26 A28 R29 V74 N77 Y87 R88 R91 L96 P97 V98 R99 G100 Q101 R102 T103 R104 N106 R108 T109 K111 R114 K115 T116 V117 K120	K11 R12 Y19 Y21 G22 I23 G24 A26 R27 V72 N75 Y85 R86 R89 L94 P95 V96 R97 G98 Q99 R100 T101 R102 N104 R106 T107 K109 R112 K113 T114 V115 K118
BS03	rna	2m	A118 G119	A116 G117

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7jqm, PDBe:7jqm, PDBj:7jqm
• PDBsum: 7jqm
• PubMed: 32787108
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)