Structure of PDB 5wis Chain 2m

Receptor sequence

>5wis2m (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAE
VVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
TRTNARTRKGPRKTVAGKKKAP

3D structure

PDB

5wis Co-produced natural ketolides methymycin and pikromycin inhibit bacterial growth by preventing synthesis of a limited number of proteins.

Chain

Resolution

2.703 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2m	K13 R14 Y21 Y23 G24 I25 G26 R29 R44 V74 N77 I78 Y87 R88 R91 H92 L96 V98 R99 Q101 R102 T103 R104 T105 N106 A107 R108 T109 K111 R114 K115 T116 V117	K11 R12 Y19 Y21 G22 I23 G24 R27 R42 V72 N75 I76 Y85 R86 R89 H90 L94 V96 R97 Q99 R100 T101 R102 T103 N104 A105 R106 T107 K109 R112 K113 T114 V115
BS02	rna	2m	K120 A123	K118 A121

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links

PDB	RCSB:5wis, PDBe:5wis, PDBj:5wis
PDBsum	5wis
PubMed	28934499
UniProt	P80377\|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)