Structure of PDB 5hcp Chain 2m

Receptor sequence
>5hcp2m (length=116) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAE
VVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
TRTNARTRKGPRKTVA
3D structure
PDB5hcp Structures of proline-rich peptides bound to the ribosome reveal a common mechanism of protein synthesis inhibition.
Chain2m
Resolution2.894 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2m R14 Y21 Y23 G24 I25 G26 A28 R29 N77 Y87 R91 V98 R99 Q101 R102 T103 R104 T105 N106 A107 R108 T109 K111 R114 K115 T116 V117 R12 Y19 Y21 G22 I23 G24 A26 R27 N75 Y85 R89 V96 R97 Q99 R100 T101 R102 T103 N104 A105 R106 T107 K109 R112 K113 T114 V115
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hcp, PDBe:5hcp, PDBj:5hcp
PDBsum5hcp
PubMed26809677
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]