Structure of PDB 7rqa Chain 2k

Receptor sequence

>7rqa2k (length=114) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

QVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQ
LAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDT
PVPHNGCRPKKKFR

3D structure

PDB

7rqa Structural basis for the context-specific action of the classic peptidyl transferase inhibitor chloramphenicol.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2k	Y20 H22 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 V47 G52 S53 K55 R85 P113 V114 P115 H116 N117 G118 C119 R120 P121 K122 K123	Y8 H10 N14 N15 I17 T19 G25 N26 P27 W30 S32 G34 V35 G40 S41 K43 R73 P101 V102 P103 H104 N105 G106 C107 R108 P109 K110 K111
BS02	MG	2k	N26 G52	N14 G40

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7rqa, PDBe:7rqa, PDBj:7rqa
PDBsum	7rqa
PubMed	35165455
UniProt	P80376\|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)