Structure of PDB 7rq9 Chain 2k

Receptor sequence

>7rq92k (length=114) Species: 300852 (Thermus thermophilus HB8)

QVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQ
LAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDT
PVPHNGCRPKKKFR

3D structure

• PDB: 7rq9 A synthetic antibiotic class overcoming bacterial multidrug resistance.
• Chain: 2k
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2k	Y20 H22 N26 N27 G37 N38 P39 I40 W42 S44 G46 V47 G52 S53 K55 R85 P113 V114 P115 H116 N117 G118 C119 R120 P121 K122 K123	Y8 H10 N14 N15 G25 N26 P27 I28 W30 S32 G34 V35 G40 S41 K43 R73 P101 V102 P103 H104 N105 G106 C107 R108 P109 K110 K111
BS02	MG	2k	N26 G52 S53	N14 G40 S41

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7rq9, PDBe:7rq9, PDBj:7rq9
• PDBsum: 7rq9
• PubMed: 34707295
• UniProt: P80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)