Structure of PDB 6cfk Chain 2k

Receptor sequence
>6cfk2k (length=114) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
QVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQ
LAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDT
PVPHNGCRPKKKFR
3D structure
PDB6cfk Binding and Action of Amino Acid Analogs of Chloramphenicol upon the Bacterial Ribosome.
Chain2k
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2k Y20 H22 N26 N27 I29 T31 G37 P39 W42 S44 G46 V47 G52 S53 K55 R85 P113 H116 N117 G118 C119 R120 K122 K123 Y8 H10 N14 N15 I17 T19 G25 P27 W30 S32 G34 V35 G40 S41 K43 R73 P101 H104 N105 G106 C107 R108 K110 K111
BS02 MG 2k N26 G52 N14 G40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cfk, PDBe:6cfk, PDBj:6cfk
PDBsum6cfk
PubMed29410130
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]