Structure of PDB 9b00 Chain 2j

Receptor sequence
>9b002j (length=96) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF
KHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.
Chain2j
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2j K7 R9 S35 G36 P37 I38 P39 L40 P41 T42 R43 V44 R45 T48 R51 G52 P53 F54 K55 H56 K57 S59 R60 E61 H62 H68 R70 L71 K3 R5 S31 G32 P33 I34 P35 L36 P37 T38 R39 V40 R41 T44 R47 G48 P49 F50 K51 H52 K53 S55 R56 E57 H58 H64 R66 L67
BS02 MG 2j R5 I74 R1 I70
External links
PDB RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum9b00
PubMed39019034
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]