Structure of PDB 7u2h Chain 2j

Receptor sequence
>7u2h2j (length=96) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF
KHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB7u2h Structural basis for the inability of chloramphenicol to inhibit peptide bond formation in the presence of A-site glycine.
Chain2j
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2j K7 H13 S35 G36 P37 I38 P39 L40 P41 R43 V44 R45 T48 R51 G52 P53 F54 K55 H56 K57 S59 R60 H62 R70 L71 K3 H9 S31 G32 P33 I34 P35 L36 P37 R39 V40 R41 T44 R47 G48 P49 F50 K51 H52 K53 S55 R56 H58 R66 L67
BS02 MG 2j I74 T100 I70 T96
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7u2h, PDBe:7u2h, PDBj:7u2h
PDBsum7u2h
PubMed35766409
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]