Structure of PDB 8vtw Chain 2i

Receptor sequence

>8vtw2i (length=126) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSK

3D structure

PDB

8vtw Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.35 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2i	Q3 Y5 T7 R9 K11 E12 V14 R16 F18 R20 Y36 Q38 G39 Y62 R66 G67 G68 G69 K70 S71 Q73 R83 R93 L102 T103 R104 R107 V108 V109 E110 R111 K112 K113 Y114 G115 H117 R120 R121 A122 Q124 Y125 S126 K127	Q2 Y4 T6 R8 K10 E11 V13 R15 F17 R19 Y35 Q37 G38 Y61 R65 G66 G67 G68 K69 S70 Q72 R82 R92 L101 T102 R103 R106 V107 V108 E109 R110 K111 K112 Y113 G114 H116 R119 R120 A121 Q123 Y124 S125 K126

External links

PDB	RCSB:8vtw, PDBe:8vtw, PDBj:8vtw
PDBsum	8vtw
PubMed	39039256
UniProt	P80374\|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)