Structure of PDB 8vtv Chain 2i

Receptor sequence

>8vtv2i (length=127) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR

3D structure

PDB

8vtv Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.55 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2i	Y5 R9 E12 V14 R16 F18 Y36 Q38 G39 R42 Y62 R66 G67 G68 G69 K70 S71 Q73 R83 L102 T103 R104 A106 R107 V108 V109 E110 R111 K112 K113 Y114 G115 H117 A119 R120 R121 Q124 Y125 S126 K127 R128	Y4 R8 E11 V13 R15 F17 Y35 Q37 G38 R41 Y61 R65 G66 G67 G68 K69 S70 Q72 R82 L101 T102 R103 A105 R106 V107 V108 E109 R110 K111 K112 Y113 G114 H116 A118 R119 R120 Q123 Y124 S125 K126 R127
BS02	rna	2i	K127 R128	K126 R127

External links

PDB	RCSB:8vtv, PDBe:8vtv, PDBj:8vtv
PDBsum	8vtv
PubMed	39039256
UniProt	P80374\|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)