Structure of PDB 7jqm Chain 2i

Receptor sequence

>7jqm2i (length=127) Species: 300852 (Thermus thermophilus HB8)

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR

3D structure

• PDB: 7jqm Peptide Inhibitors of Bacterial Protein Synthesis with Broad Spectrum and SbmA-Independent Bactericidal Activity against Clinical Pathogens.
• Chain: 2i
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2i	Q3 Y5 R9 E12 R16 F18 R20 Q38 G39 R66 G67 G68 G69 K70 S71 Q73 R83 R93 L102 T103 R104 R107 V108 V109 E110 R111 K112 K113 Y114 K116 H117 A119 R120 R121 A122 P123 Q124 Y125 S126 R128	Q2 Y4 R8 E11 R15 F17 R19 Q37 G38 R65 G66 G67 G68 K69 S70 Q72 R82 R92 L101 T102 R103 R106 V107 V108 E109 R110 K111 K112 Y113 K115 H116 A118 R119 R120 A121 P122 Q123 Y124 S125 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7jqm, PDBe:7jqm, PDBj:7jqm
• PDBsum: 7jqm
• PubMed: 32787108
• UniProt: P80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)