Structure of PDB 8g2a Chain 2h

Receptor sequence
>8g2a2h (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
DVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIP
RVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB8g2a Structural basis of Cfr-mediated antimicrobial resistance and mechanisms to evade it
Chain2h
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 2h T3 A7 D8 T11 R12 R14 N15 K21 S29 R30 F31 K56 R75 K88 P89 G90 R91 R92 Y94 V95 G96 V97 R105 S113 T114 S115 G128 G130 E132 T2 A6 D7 T10 R11 R13 N14 K20 S28 R29 F30 K55 R74 K87 P88 G89 R90 R91 Y93 V94 G95 V96 R104 S112 T113 S114 G127 G129 E131
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8g2a, PDBe:8g2a, PDBj:8g2a
PDBsum8g2a
PubMed38238495
UniProtP0DOY9|RS8_THET8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]