Structure of PDB 6of1 Chain 2h

Receptor sequence
>6of12h (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
DVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIP
RVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB6of1 Structure of Dirithromycin Bound to the Bacterial Ribosome Suggests New Ways for Rational Improvement of Macrolides.
Chain2h
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2h T3 D4 A7 T11 R12 R14 N15 R18 V19 K21 S29 R30 F31 K56 K88 P89 G90 R91 R92 Y94 G96 V97 R105 S113 T114 S115 G130 E132 T2 D3 A6 T10 R11 R13 N14 R17 V18 K20 S28 R29 F30 K55 K87 P88 G89 R90 R91 Y93 G95 V96 R104 S112 T113 S114 G129 E131
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6of1, PDBe:6of1, PDBj:6of1
PDBsum6of1
PubMed30936109
UniProtP0DOY9|RS8_THET8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]