Structure of PDB 6fkr Chain 2h

Receptor sequence

>6fkr2h (length=137) Species: 300852 (Thermus thermophilus HB8)

LTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
DVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIP
RVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW

3D structure

• PDB: 6fkr The Dolphin Proline-Rich Antimicrobial Peptide Tur1A Inhibits Protein Synthesis by Targeting the Bacterial Ribosome.
• Chain: 2h
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2h	L2 T3 D4 P5 A7 D8 T11 R12 R14 N15 V19 K21 A28 S29 F31 K56 K88 P89 G90 R91 R92 Y94 V95 G96 V97 R102 R105 S113 T114 S115 G128 V129 G130 E132	L1 T2 D3 P4 A6 D7 T10 R11 R13 N14 V18 K20 A27 S28 F30 K55 K87 P88 G89 R90 R91 Y93 V94 G95 V96 R101 R104 S112 T113 S114 G127 V128 G129 E131

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fkr, PDBe:6fkr, PDBj:6fkr
• PDBsum: 6fkr
• PubMed: 29526712
• UniProt: P0DOY9|RS8_THET8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)