Structure of PDB 8qzs Chain 2g |
>8qzs2g (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] |
AHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQ QNNIGMVVIRGNSIIMLEALERV |
|
PDB | 8qzs Structural insights into the cross-exon to cross-intron spliceosome switch |
Chain | 2g |
Resolution | 4.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
2g |
F37 M38 G64 N65 |
F34 M35 G61 N62 |
|
|
|
|