Structure of PDB 8h6j Chain 2f |
>8h6j2f (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] |
HPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMQNNIGM VVIRGNSIIMLEALER |
|
PDB | 8h6j Atomic structures of human exon-defined spliceosome prior to activation. |
Chain | 2f |
Resolution | 3.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
2f |
G64 N65 |
G55 N56 |
|
|
|
|