Structure of PDB 5wis Chain 2f

Receptor sequence
>5wis2f (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAY
PIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLAN
3D structure
PDB5wis Co-produced natural ketolides methymycin and pikromycin inhibit bacterial growth by preventing synthesis of a limited number of proteins.
Chain2f
Resolution2.703 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2f R2 Y4 Y50 E69 N73 R77 R80 R87 V90 V91 K92 R2 Y4 Y50 E69 N73 R77 R80 R87 V90 V91 K92
BS02 MG 2f R82 V85 R82 V85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wis, PDBe:5wis, PDBj:5wis
PDBsum5wis
PubMed28934499
UniProtQ5SLP8|RS6_THET8 Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]