Structure of PDB 8vty Chain 2e

Receptor sequence

>8vty2e (length=148) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR

3D structure

PDB

8vty Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2e	R14 T16 A17 R18 M19 Q20 A21 G22 R24 R25 K47 P49 K57 R64 F84 G85 A86 K92 A94 A95 T98 I101 A102 L119 T120 K121 E122 S125 R126 N127 N130 Y133	R10 T12 A13 R14 M15 Q16 A17 G18 R20 R21 K43 P45 K53 R60 F80 G81 A82 K88 A90 A91 T94 I97 A98 L115 T116 K117 E118 S121 R122 N123 N126 Y129

External links

PDB	RCSB:8vty, PDBe:8vty, PDBj:8vty
PDBsum	8vty
PubMed	39039256
UniProt	Q5SHQ5\|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]