Structure of PDB 6xqe Chain 2e

Receptor sequence
>6xqe2e (length=148) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR
3D structure
PDB6xqe Sarecycline interferes with tRNA accommodation and tethers mRNA to the 70S ribosome.
Chain2e
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2e R14 T16 A17 M19 Q20 A21 G22 R24 R25 F45 K47 K57 F84 G85 A86 K92 T98 I101 A102 L119 T120 K121 E122 S125 R126 N127 R10 T12 A13 M15 Q16 A17 G18 R20 R21 F41 K43 K53 F80 G81 A82 K88 T94 I97 A98 L115 T116 K117 E118 S121 R122 N123
BS02 MG 2e E68 D147 E64 D143
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xqe, PDBe:6xqe, PDBj:6xqe
PDBsum6xqe
PubMed32817463
UniProtQ5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]