Structure of PDB 8vtv Chain 2d

Receptor sequence

>8vtv2d (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

8vtv Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	2d	G2 R3 V8 C9 R10 R13 R14 K22 G23 E24 R25 K30 R35 R36 Y38 P40 G41 Q42 H43 Q45 K46 S52 A55 R59 Q62 R66 E72 R73 Q74 S113 R115 Q116 R118 Q119 R122 H123 H125 R132 V133 D134 L135 S137 R141 L155 E205 S208 R209	G1 R2 V7 C8 R9 R12 R13 K21 G22 E23 R24 K29 R34 R35 Y37 P39 G40 Q41 H42 Q44 K45 S51 A54 R58 Q61 R65 E71 R72 Q73 S112 R114 Q115 R117 Q118 R121 H122 H124 R131 V132 D133 L134 S136 R140 L154 E204 S207 R208
BS02	MG	2d	S83 T89	S82 T88
BS03	SF4	2d	C9 C12 L19 C26 C31 M33	C8 C11 L18 C25 C30 M32

External links

PDB	RCSB:8vtv, PDBe:8vtv, PDBj:8vtv
PDBsum	8vtv
PubMed	39039256
UniProt	P80373\|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]