Structure of PDB 6ucq Chain 2d

Receptor sequence

>6ucq2d (length=208) Species: 300852 (Thermus thermophilus HB8)

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

• PDB: 6ucq Structural basis for ribosome recycling by RRF and tRNA.
• Chain: 2d
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2d	G2 R3 I5 C9 R10 R13 R14 K22 E24 R25 K30 R35 R36 Y38 P40 G41 Q42 H43 Q45 R59 Q62 R66 S71 E72 R73 N77 G87 V112 R115 Q116 Q119 H123 H125 D134 L135 P136 Y138 L155 E205 S208 R209	G1 R2 I4 C8 R9 R12 R13 K21 E23 R24 K29 R34 R35 Y37 P39 G40 Q41 H42 Q44 R58 Q61 R65 S70 E71 R72 N76 G86 V111 R114 Q115 Q118 H122 H124 D133 L134 P135 Y137 L154 E204 S207 R208
BS02	MG	2d	C9 K22	C8 K21
BS03	MG	2d	C9 R10	C8 R9
BS04	SF4	2d	C9 C12 K18 L19 L21 K22 C26 C31 A32 M33	C8 C11 K17 L18 L20 K21 C25 C30 A31 M32
BS05	MG	2d	G23 Y106 V112 S113	G22 Y105 V111 S112

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ucq, PDBe:6ucq, PDBj:6ucq
• PDBsum: 6ucq
• PubMed: 31873307
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)