Structure of PDB 5wis Chain 2c

Receptor sequence

>5wis2c (length=206) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVAL
NVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKV
IVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGEV

3D structure

PDB

5wis Co-produced natural ketolides methymycin and pikromycin inhibit bacterial growth by preventing synthesis of a limited number of proteins.

Chain

Resolution

2.703 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2c	G2 N3 K4 I5 F10 K26 S154 G155 R156 E161 Q162 A163 W167 R172 V173 P174 L175 H176 T177 L178 R179 F186 T192 Y193 G194 V195 G197 K199	G1 N2 K3 I4 F9 K25 S153 G154 R155 E160 Q161 A162 W166 R171 V172 P173 L174 H175 T176 L177 R178 F185 T191 Y192 G193 V194 G196 K198

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5wis, PDBe:5wis, PDBj:5wis
PDBsum	5wis
PubMed	28934499
UniProt	P80372\|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]