Structure of PDB 6czr Chain 2Y

Receptor sequence
>6czr2Y (length=107) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVR
VSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCA
KCGGALD
3D structure
PDB6czr Unifying the Aminohexopyranose- and Peptidyl-Nucleoside Antibiotics: Implications for Antibiotic Design
Chain2Y
Resolution3.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 2Y M1 R2 K4 K8 K9 S17 G18 V30 P32 Y35 K46 K47 A48 V49 R50 V51 G58 G59 F60 H68 S70 K71 R73 R84 R86 K87 K95 M1 R2 K4 K8 K9 S17 G18 V30 P32 Y35 K46 K47 A48 V49 R50 V51 G58 G59 F60 H68 S70 K71 R73 R84 R86 K87 K95
BS02 ZN 2Y C76 C79 C99 C102 C76 C79 C99 C102
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6czr, PDBe:6czr, PDBj:6czr
PDBsum6czr
PubMed
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]