Structure of PDB 9b00 Chain 2X

Receptor sequence

>9b002X (length=95) Species: 300852 (Thermus thermophilus HB8)

MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

3D structure

• PDB: 9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.
• Chain: 2X
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2X	K2 S14 K16 K25 H31 T35 K36 T37 E38 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 L66 Y69 G71 K72 R73 P74 D75 K78 I80	K2 S14 K16 K25 H31 T35 K36 T37 E38 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 L66 Y69 G71 K72 R73 P74 D75 K78 I80
BS02	MG	2X	A17 Y18 A19 G20 F21	A17 Y18 A19 G20 F21

External links

• PDB: RCSB:9b00, PDBe:9b00, PDBj:9b00
• PDBsum: 9b00
• PubMed: 39019034
• UniProt: Q5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)