Structure of PDB 8t8b Chain 2X

Receptor sequence

>8t8b2X (length=95) Species: 300852 (Thermus thermophilus HB8)

MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

3D structure

• PDB: 8t8b Practical Synthesis of N -Formylmethionylated Peptidyl-tRNA Mimics.
• Chain: 2X
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2X	M1 K2 S14 K16 E23 K25 H31 K33 T35 K36 T37 E38 K40 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 L66 R68 Y69 G71 K72 R73 P74 D75 K78 I80	M1 K2 S14 K16 E23 K25 H31 K33 T35 K36 T37 E38 K40 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 L66 R68 Y69 G71 K72 R73 P74 D75 K78 I80

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8t8b, PDBe:8t8b, PDBj:8t8b
• PDBsum: 8t8b
• PubMed: 37433044
• UniProt: Q5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)