Structure of PDB 8g2b Chain 2X

Receptor sequence

>8g2b2X (length=95) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

3D structure

PDB

8g2b Structural basis of Cfr-mediated antimicrobial resistance and mechanisms to evade it

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2X	K2 S14 K16 K25 H31 T35 K36 T37 E38 K40 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 Y69 L70 G71 K72 R73 P74 K78 I80	K2 S14 K16 K25 H31 T35 K36 T37 E38 K40 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 Y69 L70 G71 K72 R73 P74 K78 I80
BS02	MG	2X	A17 G20 F21 K25 Y26 T27	A17 G20 F21 K25 Y26 T27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8g2b, PDBe:8g2b, PDBj:8g2b
PDBsum	8g2b
PubMed	38238495
UniProt	Q5SHP0\|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)