Structure of PDB 6n9e Chain 2X

Receptor sequence
>6n9e2X (length=95) Species: 274 (Thermus thermophilus) [Search protein sequence]
MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL
3D structure
PDB6n9e Mechanistic insights into the slow peptide bond formation with D-amino acids in the ribosomal active site.
Chain2X
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2X M1 K2 S14 K16 K25 T35 K36 T37 E38 K40 N41 K50 K53 N55 T56 L57 H58 R60 K62 K63 K64 Y69 G71 K72 R73 P74 D75 K78 M1 K2 S14 K16 K25 T35 K36 T37 E38 K40 N41 K50 K53 N55 T56 L57 H58 R60 K62 K63 K64 Y69 G71 K72 R73 P74 D75 K78
BS02 MG 2X E44 K50 E44 K50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n9e, PDBe:6n9e, PDBj:6n9e
PDBsum6n9e
PubMed30520988
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]