Structure of PDB 9b00 Chain 2W

Receptor sequence

>9b002W (length=112) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEKHG

3D structure

PDB

9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.

Chain

Resolution

2.8 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2W	K4 I6 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N61 H62 Y75 D77 E78 G79 P80 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 R99 H102	K4 I6 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 S53 A56 N57 N61 H62 Y75 D77 E78 G79 P80 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 R99 H102
BS02	MG	2W	R88 G91	R88 G91

External links

PDB	RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum	9b00
PubMed	39019034
UniProt	Q5SHP3\|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)