Structure of PDB 8ifd Chain 2V

Receptor sequence

>8ifd2V (length=109) Species: 9606 (Homo sapiens) [Search protein sequence]

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMSARAEAIKALVVSRKLDRLAYIAHPKLGKRARARIA
KGLRLCRPK

3D structure

PDB

8ifd Direct visualization of ribosomes in the cell-free system revealed the functional evolution of aminoglycoside.

Chain

Resolution

2.59 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2V	A2 K3 S4 K5 N6 H7 T8 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 Q27 R28 Y29 S31 L32 K33 D36 P37 K38 F39 R41 N42 R44 F45 A46 K47 H49 N50 K52 K56 M57 N60 N61 R68 S90 R91 K92 D94 R95 Y98 H101 P102 K103 R107 A108 R111 G115 R117 L118 R120 K122	A1 K2 S3 K4 N5 H6 T7 T8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 Q26 R27 Y28 S30 L31 K32 D35 P36 K37 F38 R40 N41 R43 F44 A45 K46 H48 N49 K51 K55 M56 N59 N60 R67 S77 R78 K79 D81 R82 Y85 H88 P89 K90 R94 A95 R98 G102 R104 L105 R107 K109
BS02	MG	2V	S4 K5	S3 K4

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008201	heparin binding
GO:0045296	cadherin binding

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8ifd, PDBe:8ifd, PDBj:8ifd
PDBsum	8ifd
PubMed	38227611
UniProt	P47914\|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)