Structure of PDB 7rqa Chain 2V

Receptor sequence
>7rqa2V (length=101) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTP
VVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIR
G
3D structure
PDB7rqa Structural basis for the context-specific action of the classic peptidyl transferase inhibitor chloramphenicol.
Chain2V
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2V G8 G9 K10 E23 K24 R66 K69 V72 K74 F75 A77 K78 V79 Q80 Y81 R82 R83 K84 K85 G86 H87 Q89 G8 G9 K10 E23 K24 R66 K69 V72 K74 F75 A77 K78 V79 Q80 Y81 R82 R83 K84 K85 G86 H87 Q89
BS02 MG 2V V79 Q80 V79 Q80
BS03 MG 2V Q89 P90 Q89 P90
BS04 MG 2V F75 K76 Q80 R82 F75 K76 Q80 R82
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rqa, PDBe:7rqa, PDBj:7rqa
PDBsum7rqa
PubMed35165455
UniProtP60492|RL21_THET8 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]