Structure of PDB 7rq9 Chain 2V

Receptor sequence

>7rq92V (length=101) Species: 300852 (Thermus thermophilus HB8)

MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTP
VVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIR
G

3D structure

• PDB: 7rq9 A synthetic antibiotic class overcoming bacterial multidrug resistance.
• Chain: 2V
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2V	G8 G9 K10 E23 K24 R66 K69 V72 K74 F75 K76 A77 K78 V79 Q80 Y81 R82 R83 K84 K85 G86 H87 Q89 P90	G8 G9 K10 E23 K24 R66 K69 V72 K74 F75 K76 A77 K78 V79 Q80 Y81 R82 R83 K84 K85 G86 H87 Q89 P90
BS02	MG	2V	K76 A77 Q80 R82	K76 A77 Q80 R82

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7rq9, PDBe:7rq9, PDBj:7rq9
• PDBsum: 7rq9
• PubMed: 34707295
• UniProt: P60492|RL21_THET8 Large ribosomal subunit protein bL21 (Gene Name=rplU)