Structure of PDB 8ud8 Chain 2T

Receptor sequence

>8ud82T (length=131) Species: 300852 (Thermus thermophilus HB8)

MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA

3D structure

• PDB: 8ud8 An antibiotic preorganized for ribosomal binding overcomes antimicrobial resistance
• Chain: 2T
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2T	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 F101 K113 K119	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 F101 K113 K119
BS02	rna	2T	R39 R41 S106 D107 R108 R111 R118 K119 R125	R39 R41 S106 D107 R108 R111 R118 K119 R125
BS03	MG	2T	I52 A97 K98	I52 A97 K98

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ud8, PDBe:8ud8, PDBj:8ud8
• PDBsum: 8ud8
• PubMed: 38359125
• UniProt: P60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)