Structure of PDB 8g2c Chain 2T

Receptor sequence
>8g2c2T (length=131) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA
3D structure
PDB8g2c Structural basis of Cfr-mediated antimicrobial resistance and mechanisms for its evasion
Chain2T
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2T N2 R3 G4 R23 R51 R53 R54 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 K113 K119 N2 R3 G4 R23 R51 R53 R54 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 K113 K119
BS02 rna 2T R39 R41 Q43 S106 R108 R111 R118 K119 R125 R39 R41 Q43 S106 R108 R111 R118 K119 R125
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g2c, PDBe:8g2c, PDBj:8g2c
PDBsum8g2c
PubMed38238495
UniProtP60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]