Structure of PDB 8fc1 Chain 2T

Receptor sequence

>8fc12T (length=131) Species: 300852 (Thermus thermophilus HB8)

MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA

3D structure

• PDB: 8fc1 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
• Chain: 2T
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2T	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R95 R96 A97 K98 Y100 F101 K113 R115 K119	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R95 R96 A97 K98 Y100 F101 K113 R115 K119
BS02	rna	2T	R39 R41 Q43 S106 R108 R111 R118 K119 D122 R125	R39 R41 Q43 S106 R108 R111 R118 K119 D122 R125

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fc1, PDBe:8fc1, PDBj:8fc1
• PDBsum: 8fc1
• PubMed: 37452045
• UniProt: P60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)