Structure of PDB 5w4k Chain 2T

Receptor sequence

>5w4k2T (length=131) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA

3D structure

PDB

5w4k Klebsazolicin inhibits 70S ribosome by obstructing the peptide exit tunnel.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2T	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 K113 R115 K119	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 K113 R115 K119
BS02	rna	2T	R39 R41 Q43 S106 R108 R111 R118 K119 D122	R39 R41 Q43 S106 R108 R111 R118 K119 D122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5w4k, PDBe:5w4k, PDBj:5w4k
PDBsum	5w4k
PubMed	28846667
UniProt	P60490\|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)