Structure of PDB 6ucq Chain 2S

Receptor sequence

>6ucq2S (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

3D structure

• PDB: 6ucq Structural basis for ribosome recycling by RRF and tRNA.
• Chain: 2S
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2S	R3 R9 R10 F12 R13 N16 R17 I18 T21 R23 F87 R89 Y94 R106 F112	R1 R7 R8 F10 R11 N14 R15 I16 T19 R21 F85 R87 Y92 R104 F110
BS02	rna	2S	R15 K19 R25 F29 S31 L32 K33 H34 Y36 Q38 V46 T47 S50 L54 A55 K62 T63 K93 H95 R97	R13 K17 R23 F27 S29 L30 K31 H32 Y34 Q36 V44 T45 S48 L52 A53 K60 T61 K91 H93 R95
BS03	MG	2S	A6 R9	A4 R7

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ucq, PDBe:6ucq, PDBj:6ucq
• PDBsum: 6ucq
• PubMed: 31873307
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)