Structure of PDB 8uvs Chain 2Q

Receptor sequence

>8uvs2Q (length=141) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

PDB

8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.

Chain

Resolution

2.75 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	2Q	P4 R5 R6 K8 Y9 K11 Q13 R14 R16 K18 K22 G24 F29 W41 Q46 A49 R56 K63 R67 F69 D71 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 R101 H123 K124 P126 K128	P4 R5 R6 K8 Y9 K11 Q13 R14 R16 K18 K22 G24 F29 W41 Q46 A49 R56 K63 R67 F69 D71 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 R101 H123 K124 P126 K128
BS02	rna	2Q	R16 L17 G19	R16 L17 G19
BS03	rna	2Q	R51 R60	R51 R60
BS04	MG	2Q	G84 G86	G84 G86
BS05	MG	2Q	G122 I127	G122 I127
BS06	MG	2Q	P78 N89	P78 N89

External links

PDB	RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
PDBsum	8uvs
PubMed	38165935
UniProt	P60489\|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)