Structure of PDB 5j4c Chain 2Q

Receptor sequence

>5j4c2Q (length=141) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 5j4c Insights into RNA binding by the anticancer drug cisplatin from the crystal structure of cisplatin-modified ribosome.
• Chain: 2Q
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2Q	P4 R5 K8 Y9 K11 Q12 Q13 R14 R16 K22 G24 F29 W41 Q46 A49 K63 R67 F69 D71 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 G88 R101 R119 H123 K124 P126 K128	P4 R5 K8 Y9 K11 Q12 Q13 R14 R16 K22 G24 F29 W41 Q46 A49 K63 R67 F69 D71 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 G88 R101 R119 H123 K124 P126 K128
BS02	rna	2Q	R16 L17 G19	R16 L17 G19
BS03	rna	2Q	R51 R56	R51 R56
BS04	MG	2Q	G122 L125 I127	G122 L125 I127
BS05	MG	2Q	K76 N89	K76 N89

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5j4c, PDBe:5j4c, PDBj:5j4c
• PDBsum: 5j4c
• PubMed: 27079977
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)