Structure of PDB 8vtu Chain 2P

Receptor sequence

>8vtu2P (length=149) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLE

3D structure

PDB

8vtu Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2P	S4 R7 P8 N9 A12 N13 K14 R16 K17 R18 V19 G20 R21 G22 G24 G28 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 G43 L45 K46 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 K76 R77 N84 R90 G104 L105 K107 K108 K113 L115 E117 S131 K132 S133	S4 R7 P8 N9 A12 N13 K14 R16 K17 R18 V19 G20 R21 G22 G24 G28 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 G43 L45 K46 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 K76 R77 N84 R90 G104 L105 K107 K108 K113 L115 E117 S131 K132 S133

External links

PDB	RCSB:8vtu, PDBe:8vtu, PDBj:8vtu
PDBsum	8vtu
PubMed	39039256
UniProt	Q5SHQ7\|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)

[Back to BioLiP]