Structure of PDB 7rq9 Chain 2O

Receptor sequence
>7rq92O (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL
3D structure
PDB7rq9 A synthetic antibiotic class overcoming bacterial multidrug resistance.
Chain2O
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 2O M1 Q3 Q5 T6 Y7 I22 R23 S28 N29 A30 K31 Y32 S42 K44 K66 K67 E68 K70 N82 M1 Q3 Q5 T6 Y7 I22 R23 S28 N29 A30 K31 Y32 S42 K44 K66 K67 E68 K70 N82
BS02 rna 2O P48 R49 R97 E120 V121 P48 R49 R97 E120 V121
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7rq9, PDBe:7rq9, PDBj:7rq9
PDBsum7rq9
PubMed34707295
UniProtQ5SHP8|RL14_THET8 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]