Structure of PDB 8ud8 Chain 2N

Receptor sequence

>8ud82N (length=140) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

• PDB: 8ud8 An antibiotic preorganized for ribosomal binding overcomes antimicrobial resistance
• Chain: 2N
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2N	K2 T3 V5 W13 L23 G24 R25 T28 R35 K37 N45 T63 G64 K65 K66 Q69 K70 R74 Y75 S76 Y78 P79 G80 L82 K89 R97 E100 H101 A102 G105 M106 P108 P111 L112 R114 F117 K118 P129 H130 Q133	K2 T3 V5 W13 L23 G24 R25 T28 R35 K37 N45 T63 G64 K65 K66 Q69 K70 R74 Y75 S76 Y78 P79 G80 L82 K89 R97 E100 H101 A102 G105 M106 P108 P111 L112 R114 F117 K118 P129 H130 Q133

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ud8, PDBe:8ud8, PDBj:8ud8
• PDBsum: 8ud8
• PubMed: 38359125
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)