Structure of PDB 5j4c Chain 2H

Receptor sequence

>5j4c2H (length=173) Species: 300852 (Thermus thermophilus HB8)

SRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVR
VERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGR
ALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAI
RKPSAYHEKGIYYAGEPVRLKPG

3D structure

• PDB: 5j4c Insights into RNA binding by the anticancer drug cisplatin from the crystal structure of cisplatin-modified ribosome.
• Chain: 2H
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2H	S2 R3 I4 R59 S63 G66 L67 T70 L71 K85 G108 F109 S110 H111 K138 Q139 G142 Q143 R152 Y157 H158 K160 K172	S1 R2 I3 R58 S62 G65 L66 T69 L70 K84 G107 F108 S109 H110 K137 Q138 G141 Q142 R151 Y156 H157 K159 K171

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Feb 20 04:55:50 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5j4c', asym_id = '2H', title = 'Insights into RNA binding by the anticancer drug...crystal structure of cisplatin-modified ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5j4c', asym_id='2H', title='Insights into RNA binding by the anticancer drug...crystal structure of cisplatin-modified ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '5j4c', asym_id = '2H'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='5j4c', asym_id='2H')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>