Structure of PDB 5fdv Chain 2H

Receptor sequence

>5fdv2H (length=173) Species: 300852 (Thermus thermophilus HB8)

RIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRV
ERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRA
LELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIR
KPSAYHEKGIYYAGEPVRLKPGK

3D structure

• PDB: 5fdv Structure of the mammalian antimicrobial peptide Bac7(1-16) bound within the exit tunnel of a bacterial ribosome.
• Chain: 2H
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2H	R3 I4 R59 K62 S63 G66 L67 T70 G108 F109 S110 H111 K138 Q139 G142 Q143 R152 Y157 H158 K160 K172 K175	R1 I2 R57 K60 S61 G64 L65 T68 G106 F107 S108 H109 K136 Q137 G140 Q141 R150 Y155 H156 K158 K170 K173
BS02	MG	2H	S16 V17	S14 V15

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Dec 5 11:21:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5fdv', asym_id = '2H', title = 'Structure of the mammalian antimicrobial peptide...d within the exit tunnel of a bacterial ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5fdv', asym_id='2H', title='Structure of the mammalian antimicrobial peptide...d within the exit tunnel of a bacterial ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '5fdv', asym_id = '2H'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='5fdv', asym_id='2H')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>