Structure of PDB 8fc3 Chain 2G

Receptor sequence

>8fc32G (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 8fc3 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
• Chain: 2G
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2G	K36 V38 N40 G42 L43 T71 A73 I77 N79 F80 I88 R91 S124 F125 D126 R128 N132 G134 L135 G154 M155 D156 V160	K35 V37 N39 G41 L42 T70 A72 I76 N78 F79 I87 R90 S123 F124 D125 R127 N131 G133 L134 G153 M154 D155 V159
BS02	rna	2G	P2 N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96	P1 N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95
BS03	MG	2G	R113 L139	R112 L138
BS04	MG	2G	N123 F125	N122 F124
BS05	MG	2G	R128 G129 N130	R127 G128 N129

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fc3, PDBe:8fc3, PDBj:8fc3
• PDBsum: 8fc3
• PubMed: 37452045
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)