Structure of PDB 7rq9 Chain 2G

Receptor sequence

>7rq92G (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 7rq9 A synthetic antibiotic class overcoming bacterial multidrug resistance.
• Chain: 2G
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2G	N40 G42 L43 G44 E45 T71 K75 I77 N79 F80 I88 R91 S124 D126 R128 N132 L133 G134 L135 G154 M155 D156	N39 G41 L42 G43 E44 T70 K74 I76 N78 F79 I87 R90 S123 D125 R127 N131 L132 G133 L134 G153 M154 D155
BS02	rna	2G	N27 W29 E30 Q66 A69 V70 R91 V92 T93 R95 R96 R98	N26 W28 E29 Q65 A68 V69 R90 V91 T92 R94 R95 R97
BS03	rna	2G	S76 S78	S75 S77

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7rq9, PDBe:7rq9, PDBj:7rq9
• PDBsum: 7rq9
• PubMed: 34707295
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)