Structure of PDB 6czr Chain 2G

Receptor sequence

>6czr2G (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 6czr Unifying the Aminohexopyranose- and Peptidyl-Nucleoside Antibiotics: Implications for Antibiotic Design
• Chain: 2G
• Resolution: 3.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2G	N40 L43 T71 A73 K74 K75 I77 N79 F80 I88 S124 F125 N130 N132 L133 G134 L135 R136 G154 M155 D156	N39 L42 T70 A72 K73 K74 I76 N78 F79 I87 S123 F124 N129 N131 L132 G133 L134 R135 G153 M154 D155
BS02	rna	2G	P2 N27 W29 E30 Q66 K67 P68 A69 V70 R91 V92 T93 R95 R96	P1 N26 W28 E29 Q65 K66 P67 A68 V69 R90 V91 T92 R94 R95
BS03	MG	2G	R128 G129 N130 A163	R127 G128 N129 A162

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6czr, PDBe:6czr, PDBj:6czr
• PDBsum: 6czr
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)