Structure of PDB 8h6e Chain 2D

Receptor sequence
>8h6e2D (length=181) Species: 9606 (Homo sapiens) [Search protein sequence]
SAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFT
KLVEQYTKILIPPKGLFSKLDQVCYRVEWAKFQERERKKEEEEKEKERVA
YAQIDWHDFVVVETVVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIK
VTWDGHSGSMARTQQAAQANITLQEQIEAIH
3D structure
PDB8h6e Structural Insights into Human Exon-defined Spliceosome Prior to Activation
Chain2D
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2D S506 G507 R511 S157 G158 R162
BS02 rna 2D D503 G504 H505 S506 D154 G155 H156 S157
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6e, PDBe:8h6e, PDBj:8h6e
PDBsum8h6e
PubMed38658629
UniProtQ15459|SF3A1_HUMAN Splicing factor 3A subunit 1 (Gene Name=SF3A1)

[Back to BioLiP]