Structure of PDB 8cw4 Chain 2A |
>8cw42A (length=70) Species: 562 (Escherichia coli) [Search protein sequence] |
AGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPASFIPRIV ISLIGIGSASYLVSLTGVGS |
|
PDB | 8cw4 Cryo-EM structure of the Agrobacterium tumefaciens T-pilus reveals the importance of positive charges in the lumen. |
Chain | 2A |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PGW |
2A |
S59 M62 I68 |
S32 M35 I41 |
|
|
|