Structure of PDB 6gsj Chain 2A

Receptor sequence
>6gsj2A (length=113) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQL
AALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTP
VPHNGCRPKKKFR
3D structure
PDB6gsj Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
Chain2A
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 2A Y20 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 G52 S53 K55 R85 P115 H116 N117 G118 C119 R120 K122 K123 K124 Y7 N13 N14 I16 T18 G24 N25 P26 W29 S31 G33 G39 S40 K42 R72 P102 H103 N104 G105 C106 R107 K109 K110 K111
BS02 MG 2A N26 G52 N13 G39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6gsj, PDBe:6gsj, PDBj:6gsj
PDBsum6gsj
PubMed29931292
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]